Salivary Protein Card


Accession: Sp001617    Ras-related protein Rac1   [Drosophila melanogaster]

Basic info
Organism Drosophila melanogaster
Taxonomy Insecta > Diptera > Drosophilidae > Drosophila > Drosophila melanogaster
Protein Description Ras-related protein Rac1
Mass Weight 21353.688
Isoelectric Point 8.621
Annotation
Function During various developmental processes, regulates changes in cell morphology in response to extracellular sigls (PubMed:7958857, PubMed:10323867, PubMed:24855950). During oogenesis, mediates sigling from the tyrosine kise (RTK) chemoattractant receptors (Egfr and Pvr) to the guidance pathway that control the directiol persistent collective migration of the border cell (BC) cluster through the nurse cells to the oocyte. Once activating by Pvr and Egfr, promotes the formation of forward-directed actin protrusions which stabilize the DE-cadherin (shg)-mediated adhesions. In turn, DE-mediated adhesion between the leader border cells and nurse cells further promotes Rac1 sigling creating a positive feedback loop that amplifies the output of RTK activity and leads to higher Rac activity at the front, thus promoting polarization of the border cell cluster and directiolly persistent migration (PubMed:24855950). Involved in axon outgrowth and myoblast fusion (PubMed:7958857). Plays a role in regulating dorsal closure during embryogenesis (PubMed:10323867). Involved in integrin alpha-PS3/beta-nu-mediated phagocytosis of Gram-positive S.aureus by hemocytes (PubMed:22547074).
Pfam
PF00071 Ras
Features
Feature key Position Length
Chain 1-192 192
Cross-Reference
NCBI Nucleotide U11823.1
NCBI Protein AAA62870.1
UniProt P40792
Sequence
ATGCAGGCGATCAAGTGCGTCGTCGTGGGCGACGGAGCCGTGGGAAAGACCTGCCTGCTGATCAGCTACACGACCAATGCCTTTCCCGGCGAGTACATACCCACCGTGTTCGACAACTACTCGGCCAACGTGATGGTGGACGCCAAGCCCATCAACCTGGGCCTGTGGGATACGGCCGGGCAGGAGGACTACGACCGACTGAGGCCACTGTCTTATCCCCAGACCGATGTCTTCCTCATCTGCTTCTCGCTGGTGAATCCGGCATCGTTCGAGAACGTGCGGGCCAAGTGGTATCCGGAGGTGCGCCACCACTGCCCCAGCACGCCCATCATCCTGGTGGGCACCAAGCTGGATTTGCGCGACGACAAGAACACAATCGAAAAGCTGAGGGACAAGAAACTGGTGCCCATCACCTATCCGCAGGGCCTGGCCATGGCCAAGGAAATCGGAGCGGTCAAGTATCTGGAGTGCTCGGCCCTGACGCAGAAGGGTCTGAAAACCGTTTTCGACGAGGCCATCCGGTCGGTTTTGTGCCCCGTGCTGCAGCCCAAGTCCAAGCGCAAGTGCGCCCTGCTCTAA
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDAKPINLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVNPASFENVRAKWYPEVRHHCPSTPIILVGTKLDLRDDKNTIEKLRDKKLVPITYPQGLAMAKEIGAVKYLECSALTQKGLKTVFDEAIRSVLCPVLQPKSKRKCALL

3D Structure
Not available now!
Publication