Salivary Protein Card


Accession: Sp001940    Nitrophorin-4   [Rhodnius prolixus]

Basic info
Organism Rhodnius prolixus
Taxonomy Insecta > Hemiptera > Reduviidae > Rhodnius > Rhodnius prolixus
Protein Description Nitrophorin-4
Mass Weight 22406.27
Isoelectric Point 6.81
Annotation
Function Heme-based protein that delivers nitric oxide gas (NO) to the victim while feeding, resulting in vasodilation and inhibition of platelet aggregation. Also binds tightly to histamine, which is released by the host to induce wound healing. NO release is pH dependent and linked to loop dymics. {ECO:0000269|PubMed:15157102, ECO:0000269|PubMed:15598503, ECO:0000269|PubMed:20524697, ECO:0000269|PubMed:23133364, ECO:0000269|PubMed:23885811}
Pfam
PF02087 Nitrophorin
Features
Feature key Position Length
Signal Peptide 1-21 21
Chain 22-205 184
Cross-Reference
UniProt Q94734
Sequence
MKSYTSLLAVAILCLFGGVNGACTKNAIAQTGFNKDKYFNGDVWYVTDYLDLEPDDVPKRYCAALAAGTASGKLKEALYHYDPKTQDTFYDVSELQVESLGKYTANFKKVDKNGNVKVAVTAGNYYTFTVMYADDSSALIHTCLHKGNKDLGDLYAVLNRNKDAAAGDKVKSAVSAATLEFSKFISTKENNCAYDNDSLKSLLTK

3D Structure
Not available now!
Publication
1. Montandon CE, Barros E, Vidigal PM, Mendes MT, Anh AC, de Oliveira Ramos HJ, de Oliveira CJ, de Siqueira CL.;
Development of data for the identification and characterization of proteins found in Rhodnius prolixus.;
Data Brief. 2016 Mar 19;7:844-7. 23721830