Salivary Protein Card


Accession: Sp002231    Triabin   [Triatoma pallidipennis]

Basic info
Organism Triatoma pallidipennis
Taxonomy
Protein Description Triabin
Mass Weight 18000
Isoelectric Point 6.9
Annotation
Function Triabin is a specific protein that belongs to the D12 family of proteins. It was origilly identified in the saliva of the tsetse fly, which is known to transmit African trypanosomes, the causative agents of sleeping sickness. Triabin is believed to play a role in the modulation of host immune responses and the transmission of trypanosomes. It acts by inhibiting the host immune system and promoting the survival and establishment of the parasite within the host. The exact mechanisms and interactions of triabin with the host immune system are still areas of ongoing research
Features
Feature key Position Length
1
Cross-Reference
Sequence
WYVTNAKHGSNSTVCREYNGKRENGNPVLNGDGYYSFRNLKIYFEVRCDKQSDTNYKLTFSCTQKGPAGTNMNFQFQLEVTVLSTDYDDFAIMYRCVKFPPQLGSRIEDNVLVLHRDATKTNDKNPQIEDILKKQDWSLDTFNSRDGVECPLPPQK

3D Structure
Not available now!
Publication
1. Hernndez-Vargas MJ, Gil J, Lozano L, Pedraza-Escalo M, Ortiz E,Encarcin-Guevara S, Alagn A, Corzo G.;
Proteomic and transcriptomic alysisof saliva components from the hematophagous reduviid Triatoma pallidipennis.;
J Proteomics. 2017 Jun 6;162:30-39. 28442451