Salivary Protein Card


Accession: Sp002285    Procalin - truncated at 5 prime   [Dipetalogaster maximus]

Basic info
Organism Dipetalogaster maximus
Taxonomy Insecta > Hemiptera > Reduviidae > Dipetalogaster > Dipetalogaster maximus
Protein Description Procalin - truncated at 5 prime
Mass Weight 17270
Isoelectric Point 6.18
Annotation
Function Procalin, truncated at the 5 prime end, refers to a modified or altered form of the procalin protein where the sequence at the 5 prime end has been shortened or removed. Procalin itself is a type of salivary lipocalin protein primarily found in saliva
Pfam
PF03973 Triabin
Features
Feature key Position Length
Signal Peptide 1-18 18
Chain 19-167 149
Cross-Reference
Sequence
MKTFIVITFIGILSYAYADECENPEPMQGFSASQFYQGXWYVTHETSAXTLSECNILTTSNDNGKFTVKHKYTKDGXVGELICEGQASANNKFTYDCKFXGZTMEQVTRTAMDTDYNDYALYYLCTTYKXGPNAGKKEGHYILSRRQPNTEIPDALKTKTKDLNLKLCG

3D Structure
Not available now!
Publication
1. Teresa TC, Francischetti IM, Andersen JF, Schwarz A, Santa JM, Ribeiro JM.;
An insight into the sialome of the blood-sucking bug Triatoma infestans, avector of Chagas disease.;
Insect Biochem Mol Biol. 2008 Feb;38(2):213-32. PMC2263102