Salivary Protein Card


Accession: Sp002293    Salivary lipocalin 4 - truncated at 5 prime   [Dipetalogaster maximus]

Basic info
Organism Dipetalogaster maximus
Taxonomy Insecta > Hemiptera > Reduviidae > Dipetalogaster > Dipetalogaster maximus
Protein Description Salivary lipocalin 4 - truncated at 5 prime
Mass Weight 10280
Isoelectric Point 5.04
Annotation
Function Salivary lipocalin 4, truncated at the 5 prime end, refers to a modified or altered form of the salivary lipocalin 4 protein where the sequence at the 5 prime end has been shortened or removed. Salivary lipocalin 4 is a specific member of the lipocalin protein family that is primarily found in saliva
Pfam
PF03973 Triabin
Features
Feature key Position Length
Signal Peptide 1-18 18
Chain 19-179 161
Cross-Reference
Sequence
MRTFIALSFFGILTYAYAATTGISQCQEVNGMEGFSATNFFTRTWYVTHVQKETSKTVCQTFTASKPTNTTYVVEYTFENDKGVRNNVRCEGERGEYKKITFNCKNGGTTFTAVFVVMDTDYNNYALFYRCVTMASGDKDDNYLVLSRTDGNQQIPTNLTSLTTGLDLKSCEEIKSKVL

3D Structure
Not available now!
Publication
1. Teresa TC, Francischetti IM, Andersen JF, Schwarz A, Santa JM, Ribeiro JM.;
An insight into the sialome of the blood-sucking bug Triatoma infestans, avector of Chagas disease.;
Insect Biochem Mol Biol. 2008 Feb;38(2):213-32. PMC2263122