Salivary Protein Card


Accession: Sp002494    Short salivary lipocalin   [Triatoma infestans]

Basic info
Organism Triatoma infestans
Taxonomy Insecta > Hemiptera > Reduviidae > Triatoma > Triatoma infestans
Protein Description Short salivary lipocalin
Mass Weight 12886.671
Isoelectric Point 6.12
Annotation
Function This protein belongs to the family of seed storage proteins and is similar to the 11S globulin protein found in plant seeds. Its function is related to seed development and storage. It serves as a reserve of nutrients and energy for the growing seedling during germination and early stages of plant growth.
Pfam
PF03973 Triabin
Features
Feature key Position Length
Signal Peptide 1-18 18
Chain 19-116 98
Cross-Reference
Sequence
MKTFIALTFIGILTYAYAQSSGISECKTVKAKTDFSAKRFLITGDTTFEAVFVIMDTDYNNYALFYRCVSFPTGYRDDNYLVLSRTGGGQEIPASLKSLTSDLQLQSCVNIMTVVL

3D Structure
Not available now!
Publication
1. Teresa TC, Francischetti IM, Andersen JF, Schwarz A, Santa JM, Ribeiro JM.;
An insight into the sialome of the blood-sucking bug Triatoma infestans, avector of Chagas disease.;
Insect Biochem Mol Biol. 2008 Feb;38(2):213-32. PMC2262981