Salivary Protein Card


Accession: Sp002507    Triatin-like salivary lipocalin   [Triatoma infestans]

Basic info
Organism Triatoma infestans
Taxonomy Insecta > Hemiptera > Reduviidae > Triatoma > Triatoma infestans
Protein Description Triatin-like salivary lipocalin
Mass Weight 21963.746
Isoelectric Point 8.65
Annotation
Function Triatins are a subfamily of lipocalin proteins that have been identified in the saliva of triatomine bugs, which are blood-feeding insects known for transmitting the parasite Trypanosoma cruzi, the causative agent of Chagas disease. Unlike other lipocalins, such as human salivary lipocalin (HSL), triatins have been primarily studied for their role in the modulation of the host immune system and hemostasis during blood-feeding
Pfam
PF03973 Triabin
Features
Feature key Position Length
Signal Peptide 1-16 16
Chain 17-193 177
Cross-Reference
Sequence
MKTIIIMTFFGIFAYAKNSAGVNQCHAVTPMGNFDSTKFFKGTWHMTHVTNGIFSLVCQDLETTKDGQQLFIDYSYNKNGQERNVRCKSQGQGKNGQIPFSCEINSPGFLNYFKKTKKFQATFTIMKTNYDNYALFYKCVTLESGEKTDNYVVLSRSKSDGDIPGAAKSLLEINHESMKKCSDLINADDIKSEVV

3D Structure
Not available now!
Publication
1. Teresa TC, Francischetti IM, Andersen JF, Schwarz A, Santa JM, Ribeiro JM.;
An insight into the sialome of the blood-sucking bug Triatoma infestans, avector of Chagas disease.;
Insect Biochem Mol Biol. 2008 Feb;38(2):213-32. PMC2262967